Mouse Anti-Rhesus CTSS Antibody (CBMOAB-40098FYA)


Cat: CBMOAB-40098FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40098FYA
SpecificityThis antibody binds to Rhesus CTSS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Extracellular region or secreted; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCTSS (Cathepsin S) is a Protein Coding gene. Diseases associated with CTSS include Cercarial Dermatitis and Mandibular Cancer. Among its related pathways are Bacterial infections in CF airways and Innate Immune System. Gene Ontology (GO) annotations related to this gene include peptidase activity and cysteine-type peptidase activity. An important paralog of this gene is CTSK.
Product OverviewMouse Anti-Rhesus CTSS Antibody is a mouse antibody against CTSS. It can be used for CTSS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCTSS
UniProt IDF7B4I9
Protein RefseqThe length of the protein is 331 amino acids long.
The sequence is show below: MKQLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNANQILPDSVDWREKGCVTEVKYQSSLNAYESYSPTSVFPPLLLKPETVRIWKICKGRNIRHMKKLKKGKKTYLKSRLRILVFIKELKYTSLSALYFFLQDQKCQYDSKYRAATCSKYTELPYGREDVLKEVVANKGPVSVGVDASHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGVLNGKEYWLVKNSWGRNFGEEGYIRMARNKGNHCGIASFPSYPEI.
For Research Use Only | Not For Clinical Use.
Online Inquiry