Mouse Anti-CTSS Antibody (CBMOAB-40098FYA)
Cat: CBMOAB-40098FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40098FYA | Monoclonal | Rhesus (Macaca mulatta), Bovine, Mouse, Pig, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Sheep (Ovis aries) | WB, ELISA | MO40098FYA | 100 µg | ||
| MO-AB-00282R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00282R | 100 µg | ||
| MO-AB-02745H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02745C | 100 µg | ||
| MO-AB-10936R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10936R | 100 µg | ||
| MO-AB-14776Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14776Y | 100 µg | ||
| MO-AB-19418W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19418W | 100 µg | ||
| MO-AB-29946W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29946W | 100 µg | ||
| MO-AB-44219W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44219W | 100 µg | ||
| MO-AB-53727W | Monoclonal | Marmoset | WB, ELISA | MO53727W | 100 µg | ||
| MOFY-0722-FY334 | Polyclonal | Bovine, Mouse, Pig | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Bovine, Mouse, Pig, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Sheep (Ovis aries) |
| Clone | MO40098FYA |
| Specificity | This antibody binds to Rhesus CTSS. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endosome; Extracellular region or secreted; Lysosome |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CTSS (Cathepsin S) is a Protein Coding gene. Diseases associated with CTSS include Cercarial Dermatitis and Mandibular Cancer. Among its related pathways are Bacterial infections in CF airways and Innate Immune System. Gene Ontology (GO) annotations related to this gene include peptidase activity and cysteine-type peptidase activity. An important paralog of this gene is CTSK. |
| Product Overview | Mouse Anti-Rhesus CTSS Antibody is a mouse antibody against CTSS. It can be used for CTSS detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CTSS |
| UniProt ID | F7B4I9 |
| Protein Refseq | The length of the protein is 331 amino acids long. The sequence is show below: MKQLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNANQILPDSVDWREKGCVTEVKYQSSLNAYESYSPTSVFPPLLLKPETVRIWKICKGRNIRHMKKLKKGKKTYLKSRLRILVFIKELKYTSLSALYFFLQDQKCQYDSKYRAATCSKYTELPYGREDVLKEVVANKGPVSVGVDASHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGVLNGKEYWLVKNSWGRNFGEEGYIRMARNKGNHCGIASFPSYPEI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry