Mouse Anti-Rhesus CXCR6 Antibody (CBMOAB-40164FYA)


Cat: CBMOAB-40164FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40164FYA
SpecificityThis antibody binds to Rhesus CXCR6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXCR6 (C-X-C Motif Chemokine Receptor 6) is a Protein Coding gene. Diseases associated with CXCR6 include Sarcoidosis 1 and Xanthogranulomatous Cholecystitis. Among its related pathways are Akt Signaling and Peptide ligand-binding receptors. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and C-X-C chemokine receptor activity. An important paralog of this gene is CCR7.
Product OverviewMouse Anti-Rhesus CXCR6 Antibody is a mouse antibody against CXCR6. It can be used for CXCR6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-X-C chemokine receptor type 6; CXCR6
UniProt IDF7BTV1
Protein RefseqThe length of the protein is 393 amino acids long.
The sequence is show below: MPGWLGYFSVDHSPSFTNALPTAVNVSSLDPGTDNLTALPGLQVFIRTNTMAEYDHYEDDGFLNSFNDSSQEEHQDFLQFRKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWIFGQVMCKTLLGVYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVICLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEEISTVVLATQMTLGFFLPLLAMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQTPFNLVKLIRSTHWEYYAMTSFHYTIIVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL.
For Research Use Only | Not For Clinical Use.
Online Inquiry