AibGenesis™ Mouse Anti-CXCR6 Antibody (CBMOAB-40164FYA)


Cat: CBMOAB-40164FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40164FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa) WB, ELISA MO40164FYA 100 µg
MO-AB-10986R Monoclonal Cattle (Bos taurus) WB, ELISA MO10986R 100 µg
MO-AB-24996R Monoclonal Pig (Sus scrofa) WB, ELISA MO24996R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa)
CloneMO40164FYA
SpecificityThis antibody binds to Rhesus CXCR6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CXCR6 Antibody is a mouse antibody against CXCR6. It can be used for CXCR6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-X-C chemokine receptor type 6; CXCR6
UniProt IDF7BTV1
Protein RefseqThe length of the protein is 393 amino acids long.
The sequence is show below: MPGWLGYFSVDHSPSFTNALPTAVNVSSLDPGTDNLTALPGLQVFIRTNTMAEYDHYEDDGFLNSFNDSSQEEHQDFLQFRKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWIFGQVMCKTLLGVYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVICLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEEISTVVLATQMTLGFFLPLLAMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQTPFNLVKLIRSTHWEYYAMTSFHYTIIVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL.
For Research Use Only | Not For Clinical Use.
Online Inquiry