Mouse Anti-CXorf38 Antibody (CBMOAB-40185FYA)


Cat: CBMOAB-40185FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40185FYA Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO40185FYA 100 µg
MO-AB-53776W Monoclonal Marmoset WB, ELISA MO53776W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO40185FYA
SpecificityThis antibody binds to Rhesus CXorf38.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXorf38 (Chromosome X Open Reading Frame 38) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus CXorf38 Antibody is a mouse antibody against CXorf38. It can be used for CXorf38 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCXorf38
UniProt IDF7BPN5
Protein RefseqThe length of the protein is 321 amino acids long.
The sequence is show below: MVLSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFVGREVLSFHHGLLAAAPGLGPRAVCRGGSRCSPRARQFQPQCQVCAEWKQEILRHHVNRNGDVHWGNCRPGRWPVDAWEVAKAFMPRGLADKRGPEECDAVALLSLINSCDHFVVDRKKVTEHVVVPRNSGIMHSSEMKVSSTWLRDFQMKIQNFLNEFRNIPEIVAVYSRIEQLLTSDWAVHIPEEDQRDGCECETGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLRNNEDLRNGLTEDMQKLDSLRLHQKLDSQEPGRQTPDRKA.
For Research Use Only | Not For Clinical Use.
Online Inquiry