Mouse Anti-Rhesus CYP11B2 Antibody (CBMOAB-40222FYA)


Cat: CBMOAB-40222FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40222FYA
SpecificityThis antibody binds to Rhesus CYP11B2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP11B2 (Cytochrome P450 Family 11 Subfamily B Member 2) is a Protein Coding gene. Diseases associated with CYP11B2 include Corticosterone Methyloxidase Type I Deficiency and Corticosterone Methyloxidase Type Ii Deficiency. Among its related pathways are superpathway of steroid hormone biosynthesis and Metabolism. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP11B1.
Product OverviewMouse Anti-Rhesus CYP11B2 Antibody is a mouse antibody against CYP11B2. It can be used for CYP11B2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYP11B2
UniProt IDF6QXV6
Protein RefseqThe length of the protein is 503 amino acids long.
The sequence is show below: MALRAKAEVCMAAPWLSLQRAQALSTRAARAPSTVLPFEAIPQRPGNRWLRLLQIWREQGYEHLHLEVHQTFQELGPIFRYHLGGPQMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALRNKVLQNARDSVTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSATLSFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQHYTGIVAELLLNAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNPALFPRPERYNPQRWLDIRGSGKNFHNVPFGFGMRQCLGRRLAETEMLLLLHHVLKHFLVETLTKEDIKMVYSFILRPGTFPLLTFRAIN.
For Research Use Only | Not For Clinical Use.
Online Inquiry