Mouse Anti-Rhesus CYP4F2 Antibody (CBMOAB-40301FYA)


Cat: CBMOAB-40301FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO40301FYA
SpecificityThis antibody binds to Rhesus CYP4F2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP4F2 (Cytochrome P450 Family 4 Subfamily F Member 2) is a Protein Coding gene. Diseases associated with CYP4F2 include Vitamin K Antagonists Toxicity Or Dose Selection and Inflammatory Bowel Disease 6. Among its related pathways are Arachidonic acid metabolism and Metabolism. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP4F3.
Product OverviewMouse Anti-Rhesus CYP4F2 Antibody is a mouse antibody against CYP4F2. It can be used for CYP4F2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYP4F2
UniProt IDF7F863
Protein RefseqThe length of the protein is 493 amino acids long.
The sequence is show below: MSQLSLSWLGLGPVAVSPWLLLLLVGTSWLLAHVLAWTYTFYDNSRRLRGFPQPPKRNWFWGHQGMVKSTEEGMRVLTQLVATYPQGFRVWMGPVFPLLSLCHPDIIRSVINASAAIVPKDKLFYRFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLALGSSARLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVSKRHQQFLLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVEDFLQAKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDHEPKEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGITCLLSVFGTHHNPTVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVLALTLLRFRVLPD.
For Research Use Only | Not For Clinical Use.
Online Inquiry