Mouse Anti-DCDC2B Antibody (CBMOAB-40464FYA)


Cat: CBMOAB-40464FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40464FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO40464FYA 100 µg
CBMOAB-73020FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73020FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO40464FYA
SpecificityThis antibody binds to Rhesus DCDC2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the doublecortin family. The protein encoded by this gene contains two doublecortin domains. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization. (From NCBI)
Product OverviewMouse Anti-Rhesus DCDC2B Antibody is a mouse antibody against DCDC2B. It can be used for DCDC2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDoublecortin domain-containing protein 2B; DCDC2B
UniProt IDH9FDJ0
Protein RefseqThe length of the protein is 230 amino acids long.
The sequence is show below: KRVVVYRNGDPFFPGSQLVVSQRRFPTMEAFLREVTSAVQAPLAVRALYTPCHGHPVTSLADLKNRGQYVAAGFERFYKLHYSPHGGKDPGGKSCRLQGPPVTRHLCDGAVGRWLPAGAPCYIHVFRNGDLVSPPFSLKLSQAASQDWETVLKLLTEKVKLQSGAVCKLCTLEGLPLSAREELVTGHYYVAVGEDEFKDLPYLELLVPRPSLPRGCWHPPGSKCRPHMQG.
For Research Use Only | Not For Clinical Use.
Online Inquiry