AibGenesis™ Mouse Anti-DEFB115 Antibody (MO-AB-03598W)


Cat: MO-AB-03598W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03598W Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa) WB, ELISA MO03598W 100 µg
Inquiry
MO-AB-25342R Monoclonal Pig (Sus scrofa) WB, ELISA MO25342R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa)
CloneMO03598W
SpecificityThis antibody binds to Rhesus DEFB115.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDefensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. (From NCBI)
Product OverviewMouse Anti-Rhesus DEFB115 Antibody is a mouse antibody against DEFB115. It can be used for DEFB115 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDefensin, beta 115; DEFB115
UniProt IDG7N564
Protein RefseqThe length of the protein is 88 amino acids long.
The sequence is show below: MLPDHFSPLSVDIKLFVLALDVLVVLAQTAPDGWIRRCCYGIGRCRKSCKEIERKKEKCGGKYICCVPKEKDKVSHIHDQKETSELYI.
For Research Use Only | Not For Clinical Use.
Online Inquiry