AibGenesis™ Mouse Anti-DEFB123 Antibody (CBMOAB-40610FYA)
Cat: CBMOAB-40610FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40610FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO40610FYA | 100 µg | ||
| MO-AB-00350L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00350L | 100 µg | ||
| MO-AB-07882Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07882Y | 100 µg | ||
| MO-AB-08624W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08624W | 100 µg | ||
| MO-AB-11338R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11338R | 100 µg | ||
| MO-AB-14932Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14932Y | 100 µg | ||
| MO-AB-25345R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25345R | 100 µg | ||
| MO-AB-34661W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34661W | 100 µg | ||
| MO-AB-44399W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44399W | 100 µg | ||
| MO-AB-54082W | Monoclonal | Marmoset | WB, ELISA | MO54082W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
| Clone | MO40610FYA |
| Specificity | This antibody binds to Rhesus DEFB123. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. This antimicrobial protein is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20q11.1. Two transcript variants, one protein-coding and the other not, have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus DEFB123 Antibody is a mouse antibody against DEFB123. It can be used for DEFB123 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Beta-defensin; DEFB123 |
| UniProt ID | I2CWS9 |
| Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: MKLFLLTLTVLLLLSQLTPGGTQRCWNLYGKCRHRCSKKERVYVYCLNNKMCCVKPKYQPKEKWWPF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry