AibGenesis™ Mouse Anti-DEGS2 Antibody (CBMOAB-40621FYA)


Cat: CBMOAB-40621FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40621FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO40621FYA 100 µg
CBMOAB-73288FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73288FYA 100 µg
MO-AB-02946H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02946C 100 µg
MO-AB-11358R Monoclonal Cattle (Bos taurus) WB, ELISA MO11358R 100 µg
MO-AB-54090W Monoclonal Marmoset WB, ELISA MO54090W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO40621FYA
SpecificityThis antibody binds to Rhesus DEGS2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a bifunctional enzyme that is involved in the biosynthesis of phytosphingolipids in human skin and in other phytosphingolipid-containing tissues. This enzyme can act as a sphingolipid delta(4)-desaturase, and also as a sphingolipid C4-hydroxylase. (From NCBI)
Product OverviewMouse Anti-Rhesus DEGS2 Antibody is a mouse antibody against DEGS2. It can be used for DEGS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDEGS2
UniProt IDF6Q3M0
Protein RefseqThe length of the protein is 310 amino acids long.
The sequence is show below: MGNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLALVLMQLLACWLVRRLAWRWLLFWAYAFGGCVNHSLTLAIHDISHNAAFGTGXXXXXXXAASFKKYHVDHHRYLGGDGLDVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPKAVTRMEVLNTLVQLAADVAIFALWGLKPMVYLLASSLLGLGLHPISGHFVAEHYMFLKGHETYSYYGPLNWITFNVGYHVEHHDFPSIPGYSLPLVRKMAPEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLAKDGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry