AibGenesis™ Mouse Anti-DERL3 Antibody (CBMOAB-40674FYA)


Cat: CBMOAB-40674FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40674FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO40674FYA 100 µg
CBMOAB-73360FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73360FYA 100 µg
MO-AB-01872W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01872W 100 µg
MO-AB-11371R Monoclonal Cattle (Bos taurus) WB, ELISA MO11371R 100 µg
MO-AB-25386H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25386C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO40674FYA
SpecificityThis antibody binds to Rhesus DERL3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus DERL3 Antibody is a mouse antibody against DERL3. It can be used for DERL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDERL3
UniProt IDH9H3B3
Protein RefseqThe length of the protein is 220 amino acids long.
The sequence is show below: ILFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTVSFPQALEPRARAPRGPACVGPGAVTAAPERDTVALSSLVCVEGRLCAQLQGPGLDLQCSMQNTRRCTKEPGAVPALGTHGLLAAAGQLHPRGPAGDCRGPHLLLPGGCLPQPAWRQEAPADPRLPVSVESPPSLSPPSDGTCAGLCSTRAPPHRKLLLDAPAEDPNYLPLPEEQPGPHLPPPQQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry