AibGenesis™ Mouse Anti-DIRAS1 Antibody (CBMOAB-40795FYA)


Cat: CBMOAB-40795FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40795FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO40795FYA 100 µg
MO-AB-21379W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21379W 100 µg
MO-AB-25399H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25399C 100 µg
MO-AB-54219W Monoclonal Marmoset WB, ELISA MO54219W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO40795FYA
SpecificityThis antibody binds to Rhesus DIRAS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DIRAS1 Antibody is a mouse antibody against DIRAS1. It can be used for DIRAS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDIRAS1
UniProt IDF7FWP4
Protein RefseqThe length of the protein is 198 amino acids long.
The sequence is show below: MPEQSNDYRVVVFGAGGGGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM.
For Research Use Only | Not For Clinical Use.
Online Inquiry