Mouse Anti-DIXDC1 Antibody (CBMOAB-40814FYA)
Cat: CBMOAB-40814FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40814FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset | WB, ELISA | MO40814FYA | 100 µg | ||
| MO-AB-01891W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01891W | 100 µg | ||
| MO-AB-11460R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11460R | 100 µg | ||
| MO-AB-19644W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19644W | 100 µg | ||
| MO-AB-54234W | Monoclonal | Marmoset | WB, ELISA | MO54234W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset |
| Clone | MO40814FYA |
| Specificity | This antibody binds to Rhesus DIXDC1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a positive regulator of the Wnt signaling pathway. The encoded protein is found associated with gamma tubulin at the centrosome. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus DIXDC1 Antibody is a mouse antibody against DIXDC1. It can be used for DIXDC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | DIX domain containing 1; DIXDC1 |
| UniProt ID | Q3YAL6 |
| Protein Refseq | The length of the protein is 83 amino acids long. The sequence is show below: TKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKALDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEEDHGEN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry