AibGenesis™ Mouse Anti-DNAJB13 Antibody (CBMOAB-40961FYA)


Cat: CBMOAB-40961FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40961FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO40961FYA 100 µg
CBMOAB-73803FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73803FYA 100 µg
MO-AB-03039H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03039C 100 µg
MO-AB-03620W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03620W 100 µg
MO-AB-11530R Monoclonal Cattle (Bos taurus) WB, ELISA MO11530R 100 µg
MO-AB-25415R Monoclonal Pig (Sus scrofa) WB, ELISA MO25415R 100 µg
MO-AB-54335W Monoclonal Marmoset WB, ELISA MO54335W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO40961FYA
SpecificityThis antibody binds to Rhesus DNAJB13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the heat shock protein 40 co-chaperone family which is produced in large amounts in the testis and is located on the radial spokes of the axoneme in human sperm flagella and other flagellar structures. The encoded protein associates with the sperm annulus, as part of the septin complex, through direct interaction with septin 4, during sperm terminal differentiation. Naturally occurring mutations in this gene are associated with primary ciliary dyskinesia and male infertility. (From NCBI)
Product OverviewMouse Anti-Rhesus DNAJB13 Antibody is a mouse antibody against DNAJB13. It can be used for DNAJB13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDnaJ homolog subfamily B member 13; DNAJB13
UniProt IDH9F905
Protein RefseqThe length of the protein is 294 amino acids long.
The sequence is show below: WYRRLALKHHPLKSNEPSSAEIFRQIAEAFDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSKTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVKTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT.
For Research Use Only | Not For Clinical Use.
Online Inquiry