AibGenesis™ Mouse Anti-DNAJC9 Antibody (CBMOAB-40998FYA)


Cat: CBMOAB-40998FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40998FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO40998FYA 100 µg
CBMOAB-73880FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73880FYA 100 µg
MO-AB-03053H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03053C 100 µg
MO-AB-17918W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17918W 100 µg
MO-AB-54379W Monoclonal Marmoset WB, ELISA MO54379W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO40998FYA
SpecificityThis antibody binds to Rhesus DNAJC9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DNAJC9 Antibody is a mouse antibody against DNAJC9. It can be used for DNAJC9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNAJC9
UniProt IDF6WGL3
Protein RefseqThe length of the protein is 259 amino acids long.
The sequence is show below: MGLLELCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAAYDEQGTVDEDSLVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRSIIQQAIDTGEIPSYNPFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSLKKEKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry