AibGenesis™ Mouse Anti-DQX1 Antibody (CBMOAB-41185FYA)


Cat: CBMOAB-41185FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41185FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO41185FYA 100 µg
MO-AB-11672R Monoclonal Cattle (Bos taurus) WB, ELISA MO11672R 100 µg
MO-AB-54492W Monoclonal Marmoset WB, ELISA MO54492W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO41185FYA
SpecificityThis antibody binds to Rhesus DQX1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DQX1 Antibody is a mouse antibody against DQX1. It can be used for DQX1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-dependent RNA helicase DQX1; DQX1
UniProt IDH9FK41
Protein RefseqThe length of the protein is 154 amino acids long.
The sequence is show below: LPPRVLPLHPDCGQAVQAVYEDMDARKVVVTHWLADFSFSLPSIQHVIDSGLELRSVYNPRIRAEFQVLRPISKCQAEARRLRARGFPPGSCLCLYPKSFLELEAPPLPQPRVCEENLSSLVLLLKRRQIAEPGECHFLDQPAPEALMQALEDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry