Mouse Anti-DTL Antibody (CBMOAB-41252FYA)


Cat: CBMOAB-41252FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41252FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO41252FYA 100 µg
CBMOAB-74160FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74160FYA 100 µg
MO-AB-19768W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19768W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO41252FYA
SpecificityThis antibody binds to Rhesus DTL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytoskeleton; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus DTL Antibody is a mouse antibody against DTL. It can be used for DTL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDTL
UniProt IDF6SRE7
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: MLFNSVLRQPQLGVLRNAPNMEHVLAVANEEGFVRLYNTESQTFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYRQVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGIFKSDFGFHWLYFIC.
For Research Use Only | Not For Clinical Use.
Online Inquiry