AibGenesis™ Mouse Anti-DUOXA2 Antibody (CBMOAB-41296FYA)


Cat: CBMOAB-41296FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41296FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO41296FYA 100 µg
MO-AB-15116Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15116Y 100 µg
MO-AB-25485R Monoclonal Pig (Sus scrofa) WB, ELISA MO25485R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO41296FYA
SpecificityThis antibody binds to Rhesus DUOXA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma Membrane; Endoplasmic reticulum; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an endoplasmic reticulum protein that is necessary for proper cellular localization and maturation of functional dual oxidase 2. Mutations in this gene have been associated with thyroid dyshormonogenesis 5. (From NCBI)
Product OverviewMouse Anti-Rhesus DUOXA2 Antibody is a mouse antibody against DUOXA2. It can be used for DUOXA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDUOXA2
UniProt IDF7G0E3
Protein RefseqThe length of the protein is 320 amino acids long.
The sequence is show below: MTLWNGVLPFYPQPRHAAGFSVPLLIVILVFLALAASFLLILPGIRGHSRWFWLVRVLLSLFIGAEIVAVHFSAEWFVGRVNTNTSYKAFSAARVTARVGLLVGLEGINITLTGTPVHQLNETIDYNEQFTWRLRDNYAAEYANALEKGLPNPVLYLAEKFTPSSPCGLYHQYRLAGHYASATLWVAFCFWLLSNVLLSTPAPLYGGLALLTTGAFALFGIFAFASISSVPLCPLRLGSAVLTAQYGAAFWVTLATGILCLFLGGAVVSLHYVRPSALRTLLDQSAEDCSQAKGGSPLILGNPLHKQAALPDLKFITTNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry