AibGenesis™ Mouse Anti-EBPL Antibody (CBMOAB-41416FYA)


Cat: CBMOAB-41416FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41416FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO41416FYA 100 µg
CBMOAB-74363FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74363FYA 100 µg
MO-AB-03166H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03166C 100 µg
MO-AB-17404W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17404W 100 µg
MO-AB-25558H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25558C 100 µg
MO-AB-54659W Monoclonal Marmoset WB, ELISA MO54659W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO41416FYA
SpecificityThis antibody binds to Rhesus EBPL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus EBPL Antibody is a mouse antibody against EBPL. It can be used for EBPL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEBPL
UniProt IDF7HCL8
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: MGAEWELGAEAGGSLLLCAALLAAGCALGLRLGRGRGAADRWALIWLCYDALVHFALEGPFVYLSLVGNVANSDGLIASLYYWLPGNEGRGGSSKKNIIARCPSSVLLEGGETLCVTFGVGCDHMYLHFLQITLCVCELYGCWMTFLPEWLTRSPNLNTSNWLYCWVYLFFFNGVWVLIPGLLLWQSWVELKKMHQKETSSVKKFQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry