Mouse Anti-ECEL1 Antibody (CBMOAB-41425FYA)


Cat: CBMOAB-41425FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41425FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset WB, ELISA MO41425FYA 100 µg
MO-AB-03171H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03171C 100 µg
MO-AB-54665W Monoclonal Marmoset WB, ELISA MO54665W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset
CloneMO41425FYA
SpecificityThis antibody binds to Rhesus ECEL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the M13 family of endopeptidases. Members of this family are zinc-containing type II integral-membrane proteins that are important regulators of neuropeptide and peptide hormone activity. Mutations in this gene are associated with autosomal recessive distal arthrogryposis, type 5D. This gene has multiple pseudogenes on chromosome 2. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus ECEL1 Antibody is a mouse antibody against ECEL1. It can be used for ECEL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesECEL1
UniProt IDH9H3W2
Protein RefseqThe length of the protein is 774 amino acids long.
The sequence is show below: MEPPYSLTAHYDEFQEVKYVSRCGAGGARGASLPPGFPLGAARSATGARSGLPRWNRREVCLLSGLVFAAGLCAILAAMLALKYLGPVAAGGGACPEGCPERKAFARAARFLAANLDASIDPCQDFYSFACGGWLRRHAIPDDKLTYGTIAAIGEQNEERLRRLLARPGGGPGGAAQRKVRAFFRSCLDMHEIERLGPRPMLEVIEDCGGWDLGGAEERPGVAARWDLNRLLYKAQGVYSAAALFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDEESEKILAAYRVFMERVLSLLGADAVEQKAQEILQVEQRLANITVSEYDDLRRDVSSMYNKVTLGQLQKITPHLRWKWLLDQIFQEDFSEEEEVVLLATDYMQQVSQLIRSTPRRVLHNYLVWRVVVVLSEHLSPPFREALHELAREMEGSDKPQELARVCLGQANRHFGMALGALFVHEHFSAASKAKVQQLVEDIKYILGQRLDELDWMDAETRAAARAKLQYMMVMVGYPDFLLKPDAVDKEYEFEVHEKTYFKNILNSIRFSIQLSVKKIRQEVDKSTWLLPPQALNAYYLPNKNQMVFPAGILQPTLYDPDFPHWVQESGQLWTLAPHCILGYLEKCVGLLFVTSWGLPYLFEAHFDVSKAECIVRLYDNFTVYNQRVNGKHTLGENIADMGGLKLAYHAYQKWVREHGPEHPLPRLKYTHDQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPEHYRVLGSVSQFEEFGRAFHCPKDTPMNPAHKCSVW.
For Research Use Only | Not For Clinical Use.
Online Inquiry