AibGenesis™ Mouse Anti-ECT2L Antibody (CBMOAB-41446FYA)


Cat: CBMOAB-41446FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41446FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO41446FYA 100 µg
CBMOAB-74416FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74416FYA 100 µg
MO-AB-54678W Monoclonal Marmoset WB, ELISA MO54678W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO41446FYA
SpecificityThis antibody binds to Rhesus ECT2L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ECT2L Antibody is a mouse antibody against ECT2L. It can be used for ECT2L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesECT2L
UniProt IDF7GMW1
Protein RefseqThe length of the protein is 215 amino acids long.
The sequence is show below: GRKAQSMGIFSDGDSREINLLQGYKIGVKNLLRPEVRDFWEKLGSYVATEEEGGHVDFFVPLGASEAGTEVLSQLSQLTGTFFTAPTGIATGSYQHILSDWLGSQWGKAPSSIYFCEAKLQTWSSFADFLEETLKTVRKQLYPLFKELQKSISGRMIGQFMFDTMGMTNILNNQETAQALADRLMELSKEDSVSVLKKVNYENQHLNTFCLQLLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry