AibGenesis™ Mouse Anti-ELK4 Antibody (CBMOAB-41676FYA)


Cat: CBMOAB-41676FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41676FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO41676FYA 100 µg
CBMOAB-74851FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74851FYA 100 µg
MO-AB-03260H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03260C 100 µg
MO-AB-11966R Monoclonal Cattle (Bos taurus) WB, ELISA MO11966R 100 µg
MO-AB-15300W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15300W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO41676FYA
SpecificityThis antibody binds to Rhesus ELK4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ELK4 Antibody is a mouse antibody against ELK4. It can be used for ELK4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesELK4
UniProt IDF7GME0
Protein RefseqThe length of the protein is 403 amino acids long.
The sequence is show below: MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKEKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVVATISTSPSISPSSEETIQALETLVSPKLPSLEAPTSASNVTTVFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELAENLSLEPKDQDSVLPEKDKANNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTIM.
For Research Use Only | Not For Clinical Use.
Online Inquiry