Mouse Anti-EME2 Antibody (CBMOAB-41716FYA)


Cat: CBMOAB-41716FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41716FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus) WB, ELISA MO41716FYA 100 µg
MO-AB-01751Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01751Y 100 µg
MO-AB-12010R Monoclonal Cattle (Bos taurus) WB, ELISA MO12010R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus)
CloneMO41716FYA
SpecificityThis antibody binds to Rhesus EME2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus EME2 Antibody is a mouse antibody against EME2. It can be used for EME2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEME2
UniProt IDF6Y7W0
Protein RefseqThe length of the protein is 445 amino acids long.
The sequence is show below: MARVGPGRAGVSRQGRGRGRGGSGQRRPPTWEISDSDAEGPSGSEAAPRARDPAGERRAAAEELRLLRPEQVLKRLAVCVDPGAAEGTGDARGRKGRSPPGGALRPTGAGRARRGPDPCPRSLPPEVWAADEQEFLLLLDPEEFLQGVATLTQISGPTRWVPWISPETTARSHLAVIGLDAYLWYRSSCPQQEWLGWGFRGADPTSPGGLWQRPRSGRAGPMGNREEWSPLFRSRQHVAPGTQQPENPKVAGAEVAIGWPQVEEVRACLSWALVLLQLWANLDVLLLASWQELSQHVCAITKALAQCPLKCVTPGLKGAGGRITSRQYRESQAFSFCTAGRWAAGEPVARDGTGLRGAWRRQIRQFSRVSPAVADAVVTAFPSPRLLQQALEACSTEQERMGLLADLPVLPSEGGRPRRVGPDLSRRICLFLTTANPDLLLDLGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry