AibGenesis™ Mouse Anti-EMR3 Antibody (CBMOAB-41747FYA)


Cat: CBMOAB-41747FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41747FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa) WB, ELISA MO41747FYA 100 µg
MO-AB-25584R Monoclonal Pig (Sus scrofa) WB, ELISA MO25584R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa)
CloneMO41747FYA
SpecificityThis antibody binds to Rhesus EMR3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus EMR3 Antibody is a mouse antibody against EMR3. It can be used for EMR3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEMR3
UniProt IDF6TBZ2
Protein RefseqThe length of the protein is 303 amino acids long.
The sequence is show below: SQEEDPVLTIITYVGLSLSLLCLLLAALTFLLCKTIQNTSTSLHLQLSLCLFVAHLLFLVGIDQTESKVLCAIIAGALHYLYLAAFTWMLLEGLHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVAISAASRPHLYGTADRCWLHLDQGFIWGFLGPVCAIFSVNLVFFILVFWILKRKLSSLNSEVSTIQNTRMLAFKATAQLFILGCTWCLGFLQVGPAAQVVAYLFTIINSLQGFFIFLVYCLLSQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry