Mouse Anti-ENAH Antibody (CBMOAB-41752FYA)


Cat: CBMOAB-41752FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41752FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO41752FYA 100 µg
CBMOAB-59822FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59822FYC 100 µg
CBMOAB-74989FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74989FYA 100 µg
MO-AB-03301H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03301C 100 µg
MO-AB-54937W Monoclonal Marmoset WB, ELISA MO54937W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO41752FYA
SpecificityThis antibody binds to Rhesus ENAH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the enabled/ vasodilator-stimulated phosphoprotein. Members of this gene family are involved in actin-based motility. This protein is involved in regulating the assembly of actin filaments and modulates cell adhesion and motility. Alternate splice variants of this gene have been correlated with tumor invasiveness in certain tissues and these variants may serve as prognostic markers. A pseudogene of this gene is found on chromosome 3. (From NCBI)
Product OverviewMouse Anti-Rhesus ENAH Antibody is a mouse antibody against ENAH. It can be used for ENAH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesENAH
UniProt IDF6W0D8
Protein RefseqThe length of the protein is 460 amino acids long.
The sequence is show below: GPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAGKKFSLPPCSSPLRYSSSSSEQKLSTSSPVNTPSSQPPATKPSAPPPPPPLPSLASLSHCGSQASPPPSTPIASTPSSKPSPAETPAQQVPPPPPPPPAPPLPASGFFLASVSEDNRPLTGLAAAIAGAKLRKVSRMEDASFPSGGNAIGVNSASSKADTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTVETEQKEDKGEDSEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA.
For Research Use Only | Not For Clinical Use.
Online Inquiry