AibGenesis™ Mouse Anti-ENDOU Antibody (CBMOAB-41764FYA)


Cat: CBMOAB-41764FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41764FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO41764FYA 100 µg
CBMOAB-74997FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74997FYA 100 µg
MO-AB-03663W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03663W 100 µg
MO-AB-12023R Monoclonal Cattle (Bos taurus) WB, ELISA MO12023R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio)
CloneMO41764FYA
SpecificityThis antibody binds to Rhesus ENDOU.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein with protease activity and is expressed in the placenta. The protein may be useful as a tumor marker. Multiple alternatively spliced transcript variants have been found for this protein. (From NCBI)
Product OverviewMouse Anti-Rhesus ENDOU Antibody is a mouse antibody against ENDOU. It can be used for ENDOU detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesENDOU
UniProt IDF7H695
Protein RefseqThe length of the protein is 411 amino acids long.
The sequence is show below: MRACIPLVLAVLCSLAWAGKMESCASRCNEKFNRDAACQCDRRCLRHGNCCEDYEHLCTEDHKESEPLPQPEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEGFSHSSDAITKEEIQSISEKIYRADTNKAQKEDIILNSQNCISLSETRDQRDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRYGSEQEFINDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKHIATAYIVSSA.
For Research Use Only | Not For Clinical Use.
Online Inquiry