Mouse Anti-ESCO2 Antibody (CBMOAB-41994FYA)


Cat: CBMOAB-41994FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41994FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Medaka (Oryzias latipes), Zebrafish (Danio rerio) WB, ELISA MO41994FYA 100 µg
CBMOAB-75334FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75334FYA 100 µg
MO-AB-00464R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00464R 100 µg
MO-AB-10783W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10783W 100 µg
MO-AB-12138R Monoclonal Cattle (Bos taurus) WB, ELISA MO12138R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Medaka (Oryzias latipes), Zebrafish (Danio rerio)
CloneMO41994FYA
SpecificityThis antibody binds to Rhesus ESCO2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that may have acetyltransferase activity and may be required for the establishment of sister chromatid cohesion during the S phase of mitosis. Mutations in this gene have been associated with Roberts syndrome. (From NCBI)
Product OverviewMouse Anti-Rhesus ESCO2 Antibody is a mouse antibody against ESCO2. It can be used for ESCO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesN-acetyltransferase ESCO2; ESCO2
UniProt IDH9Z5Q4
Protein RefseqThe length of the protein is 600 amino acids long.
The sequence is show below: MAALTPRKRKQDSLNCDSLLHFTENLFPSPNKKHCFNQNSDKNEENLHCSQQGHFVLSALKTTEINRLPSANQGSQFKSSVSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDISFPIVTEKMQGKPVCSKNNNKKPQKSLTAKYQPRYRHIKPVSRNSRNPKQNRVIYKPIMEKENNCHSAENNPSAPRVLSQKIKPQVTLQGGAAFFVSRKKSSLRKWSLENELSRGTQKNKSAVIEDSDVKTVSEKKAFETRQVPKCLILEEKLNIGLSASSKNQEELIKDSSDDRVSSKEHKVDKNEAFPSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQLSVGSINFLKQTNIQKNTNTRDTSKKTKDQLIIDAGQKHFGATVCKSCGMIYTASNPEDEMQHVQHHHRFLEGIKYVGWKKERVVAEFWDGKIVLVLPHDPSFAIKKVEDVQELVDNELGFQQVVPKCPNKIKTFLFISDEKRVVGCLIAEPIKQAFRVLSEPAGPGSPTSTECSRAWQCSDVPEPAVCGISRIWVFRLKRRKRIARRLVDTLRNCFMFGCFLSTDEIAFSDPTPDGKLFATKYCNTPNFLVYNFNS.
For Research Use Only | Not For Clinical Use.
Online Inquiry