AibGenesis™ Mouse Anti-EXD2 Antibody (CBMOAB-42065FYA)


Cat: CBMOAB-42065FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42065FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO42065FYA 100 µg
CBMOAB-75500FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75500FYA 100 µg
MO-AB-03399H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03399C 100 µg
MO-AB-24510W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24510W 100 µg
MO-AB-30731W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30731W 100 µg
MO-AB-55154W Monoclonal Marmoset WB, ELISA MO55154W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO42065FYA
SpecificityThis antibody binds to Rhesus EXD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus EXD2 Antibody is a mouse antibody against EXD2. It can be used for EXD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEXD2
UniProt IDF7B2U3
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MSRQNFVALTVTTLLGVAIGGFVLWKGIQRRRRSKTSPVTPQPQQKVLGSRELPAPEDDQLHSSTPRSSWEEQILKAKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWEHHGTYLQWLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry