AibGenesis™ Mouse Anti-EYA3 Antibody (CBMOAB-42119FYA)


Cat: CBMOAB-42119FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42119FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO42119FYA 100 µg
CBMOAB-75591FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75591FYA 100 µg
MO-AB-01814Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01814Y 100 µg
MO-AB-03417H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03417C 100 µg
MO-AB-15207Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15207Y 100 µg
MO-AB-15817W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15817W 100 µg
MO-AB-55197W Monoclonal Marmoset WB, ELISA MO55197W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO42119FYA
SpecificityThis antibody binds to Rhesus EYA3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. It can act as a mediator of chemoresistance and cell survival in Ewing sarcoma cells, where this gene is up-regulated via a micro-RNA that binds to the 3' UTR of the transcript. A similar protein in mice acts as a transcriptional activator. Alternative splicing of this gene results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus EYA3 Antibody is a mouse antibody against EYA3. It can be used for EYA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEYA3
UniProt IDF7GVJ6
Protein RefseqThe length of the protein is 536 amino acids long.
The sequence is show below: MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLTSNLPISEEIMTCTDYIPRSSNDYTSQMYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQACYPSSSFGVTGQTNTDAESTTLAATTYQSEKPSVMVPAPAAQRLSSGDPSTSPSLSQTTPNKDADDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYRKVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPALAKVLLYGLGEIFPIENIYSATKIGKESCFERIVSRFGKKVTYVVIGDGRDEEIAAKQQLYFLDLEALGCQLEPTALILFIQLSRNLSNYNKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry