AibGenesis™ Mouse Anti-FAM127C Antibody (CBMOAB-42234FYA)


Cat: CBMOAB-42234FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42234FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO42234FYA 100 µg
MO-AB-17688W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17688W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO42234FYA
SpecificityThis antibody binds to Rhesus FAM127C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM127C Antibody is a mouse antibody against FAM127C. It can be used for FAM127C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM127C
UniProt IDF6TZ10
Protein RefseqThe length of the protein is 208 amino acids long.
The sequence is show below: MGGGRGLLGRETLEPGGGCSGEGPLCYWPPPGSPQAPSLRTSLPLEPPRCPLRSCPLPRSACLCSRNSAPGSCCRPWASLWSEPPPSPSSQPAPPMHIWTLSCAPAASWAPVTHWTDHPLPPLPSPLLPTRLPDDYIILPTDLRCHCHRHPSHPTDRLLLLVIWTHLGGIWAGHSPWTVIQTAGPPRDLSPSARPISSPPPETSCVPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry