AibGenesis™ Mouse Anti-FAM131C Antibody (CBMOAB-42248FYA)


Cat: CBMOAB-42248FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42248FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO42248FYA 100 µg
CBMOAB-75772FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75772FYA 100 µg
MO-AB-18319W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18319W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO42248FYA
SpecificityThis antibody binds to Rhesus FAM131C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM131C Antibody is a mouse antibody against FAM131C. It can be used for FAM131C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FAM131C; FAM131C
UniProt IDH9FD25
Protein RefseqThe length of the protein is 86 amino acids long.
The sequence is show below: TRNCTPRTAPRASSSSKIWRASTFRTAFPVAPRRMTAFRPSPRPASPLRAVPHWRSPPAPLASHSPPAQSCSISGGGPGTKDPRVG.
For Research Use Only | Not For Clinical Use.
Online Inquiry