AibGenesis™ Mouse Anti-FAM156B Antibody (CBMOAB-42289FYA)


Cat: CBMOAB-42289FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42289FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO42289FYA 100 µg
MO-AB-15148W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15148W 100 µg
MO-AB-25729H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25729C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO42289FYA
SpecificityThis antibody binds to Rhesus FAM156B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM156B Antibody is a mouse antibody against FAM156B. It can be used for FAM156B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FAM156A; FAM156B
UniProt IDH9F3L5
Protein RefseqThe length of the protein is 210 amino acids long.
The sequence is show below: LQKRNPASPSKSSLMTAAETSQEDPASSQPSYSEQPMMGLSNLSPGPGPSQAVPLPEGLLHQRYREEKTLEERQWERLEFLQRKKAFLRHVRRRHRDHMAPYAVGREARISPLGDRGQNRFRCECRYCQSHRPNLSGIPGESNRAPQPSSWETLVQGLSGLTLSLGTNQPGPLPEAALQPQETEEKRQRERQQESKIMFQRLLKQWLEEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry