AibGenesis™ Mouse Anti-FAM168B Antibody (CBMOAB-42309FYA)


Cat: CBMOAB-42309FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42309FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO42309FYA 100 µg
CBMOAB-75826FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75826FYA 100 µg
MO-AB-12299R Monoclonal Cattle (Bos taurus) WB, ELISA MO12299R 100 µg
MO-AB-21036W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21036W 100 µg
MO-AB-25737H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25737C 100 µg
MO-AB-25761R Monoclonal Pig (Sus scrofa) WB, ELISA MO25761R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO42309FYA
SpecificityThis antibody binds to Rhesus FAM168B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM168B Antibody is a mouse antibody against FAM168B. It can be used for FAM168B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM168B
UniProt IDF6UFT4
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPCVSSPQAVPMSPCADQWARQLSQMSGQSFVFLAGLLCWPHGELESLMDCN.
For Research Use Only | Not For Clinical Use.
Online Inquiry