AibGenesis™ Mouse Anti-FAM171A2 Antibody (CBMOAB-42316FYA)


Cat: CBMOAB-42316FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42316FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO42316FYA 100 µg
CBMOAB-75833FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75833FYA 100 µg
MO-AB-03462H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03462C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO42316FYA
SpecificityThis antibody binds to Rhesus FAM171A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM171A2 Antibody is a mouse antibody against FAM171A2. It can be used for FAM171A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FAM171A2; FAM171A2
UniProt IDH9F017
Protein RefseqThe length of the protein is 579 amino acids long.
The sequence is show below: MPPASGPSVLARLLPLLGLLLGSASRAPGKSPPEPPSPQEILIKVQVYVSGELVPLARASVDVFGNRTLLAAGTTDSEGVATLPLSYRLGTWVLVTAARPGFLTNSVPWRVDKLPLYASVSLYLLPERPATLILYEDLVHILLGSPGARSQPLVQFQRRAARLPVSSTYSQLWASLTPASTQQEMRAFPAFLGTEASSSGNGSWLELMPLAAVSVHLLTGNGTEVPLSGPIHLSLPVPSETRALTVGTSIPAWRFDPKSGLWVRNGTGIIRKEGRQLYWTFVSPQLGYWVAAMASPTAGLVTITSGIQDIGTYHTIFLLTILAALALLVLILLCLLIYYCRRRCLKPRQQHRKLQLSGPSDGNKRDQATSMSQLHLICGGPLEPAPSGDPEAPPPGPLHSAFSSSRDLASSRDDFFRTKPRSASRPAAEPSGARGGESAGLKGARSAEGPGGLEPGLEEYRRGPSGAAAFLHEPPSPPPPFDHYLGHKGAAESKTPDFLLSQSVDQLARPPSLGQAGQLIFCGSIDHLKDNVYRNVMPTLVIPAHYVRLGGEAGAAGVGDEPAPPECKAPGLARAFPQP.
For Research Use Only | Not For Clinical Use.
Online Inquiry