AibGenesis™ Mouse Anti-FAM177B Antibody (CBMOAB-42329FYA)


Cat: CBMOAB-42329FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42329FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO42329FYA 100 µg
MO-AB-03692W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03692W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO42329FYA
SpecificityThis antibody binds to Rhesus FAM177B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM177B Antibody is a mouse antibody against FAM177B. It can be used for FAM177B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM177B
UniProt IDF6V538
Protein RefseqThe length of the protein is 80 amino acids long.
The sequence is show below: MEIDGFQQLDLEKSVPSKKTTPKRIIHFVDGDIMEEYSTEEEEEEEKEEQSTNATLDPSKLSWGPYLRFWAGRIASTSFS.
For Research Use Only | Not For Clinical Use.
Online Inquiry