AibGenesis™ Mouse Anti-FAM178B Antibody (CBMOAB-42333FYA)


Cat: CBMOAB-42333FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42333FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO42333FYA 100 µg
CBMOAB-59897FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59897FYC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO42333FYA
SpecificityThis antibody binds to Rhesus FAM178B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM178B Antibody is a mouse antibody against FAM178B. It can be used for FAM178B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM178B
UniProt IDF7E4L8
Protein RefseqThe length of the protein is 91 amino acids long.
The sequence is show below: LSLQACYLCHSLLTLAGVVVSCRDVTPDQWGELQLLCMQLDRHISAQIRESPQATHHTMLKDLATQTYIRWQELLTHCQPQAQYFSPWKNI.
For Research Use Only | Not For Clinical Use.
Online Inquiry