AibGenesis™ Mouse Anti-FAM219B Antibody (CBMOAB-42420FYA)


Cat: CBMOAB-42420FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42420FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO42420FYA 100 µg
CBMOAB-75940FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75940FYA 100 µg
MO-AB-13940W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13940W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO42420FYA
SpecificityThis antibody binds to Rhesus FAM219B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM219B Antibody is a mouse antibody against FAM219B. It can be used for FAM219B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM219B
UniProt IDH9H3I0
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MATAELSGRAVRLSTPGPRPSGARDRAPGAAGPPSGQIGNRALRLGERTPAAVEKRGPYMVTRAPSIQAKLQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSDGELESRYSSGYSSAEATVNQDVSRQLLQDGYHLDEIPDDEDLDLIPPKPMASSACSCCWCCLGDSSSCTLQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry