Mouse Anti-FAM243A Antibody (MO-AB-03697W)


Cat: MO-AB-03697W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03697W Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO03697W 100 µg
MO-AB-25760H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25760C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO03697W
SpecificityThis antibody binds to Rhesus FAM243A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM243A Antibody is a mouse antibody against FAM243A. It can be used for FAM243A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM243A
UniProt IDG7MMU4
Protein RefseqThe length of the protein is 251 amino acids long.
The sequence is show below: MPRFASPLLRNVIIRSQFDGIKRKQCLQYLKTLRTLQYDGFKTVYFGETNISESLVTGEDISDGYFIQTPTWCIVHAAGSQGWVPWKYRMFLRDELCIKQEDSLFSEFCDVVRKAYGKCVIVVKERRQQEEQRPKEDREAEGQFYIPTVINLASIACCPEVAKSYGHELLSLPSPCNYLNPLDSAWSSLKWFIINNRKEFCLQSIDSVYSYECILFSSLISKGIERINPSKWRTLTSKVRRWENYYLGKFS.
For Research Use Only | Not For Clinical Use.
Online Inquiry