Mouse Anti-FAM45A Antibody (CBMOAB-42454FYA)
Cat: CBMOAB-42454FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO42454FYA |
| Specificity | This antibody binds to Rhesus FAM45A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endosome; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | FAM45A (Family With Sequence Similarity 45 Member A) is a Protein Coding gene. |
| Product Overview | Mouse Anti-Rhesus FAM45A Antibody is a mouse antibody against FAM45A. It can be used for FAM45A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein FAM45A; FAM45A |
| UniProt ID | H9EVJ4 |
| Protein Refseq | The length of the protein is 357 amino acids long. The sequence is show below: MAAAEVVDTQLMLGVGLIEKDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENKLLHPFVFGQYRRTWFYITTIEVPESSILKKVTHFSIVLTTKDFNPEKYAAFTRILCRMYLKHGSPVKMMESYIAVLTKGICQSEENGSFLSKDFDVRKAYLAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEAVQEFTRTLPALVWHRQDWTILHSYMHLNADELEALQMCTGYIAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSDSQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRFPPATENFLYHLAAAEQMLKI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry