AibGenesis™ Mouse Anti-FAM45A Antibody (CBMOAB-42454FYA)


Cat: CBMOAB-42454FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42454FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO42454FYA 100 µg
CBMOAB-75966FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75966FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO42454FYA
SpecificityThis antibody binds to Rhesus FAM45A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFAM45A (Family With Sequence Similarity 45 Member A) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus FAM45A Antibody is a mouse antibody against FAM45A. It can be used for FAM45A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FAM45A; FAM45A
UniProt IDH9EVJ4
Protein RefseqThe length of the protein is 357 amino acids long.
The sequence is show below: MAAAEVVDTQLMLGVGLIEKDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENKLLHPFVFGQYRRTWFYITTIEVPESSILKKVTHFSIVLTTKDFNPEKYAAFTRILCRMYLKHGSPVKMMESYIAVLTKGICQSEENGSFLSKDFDVRKAYLAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEAVQEFTRTLPALVWHRQDWTILHSYMHLNADELEALQMCTGYIAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSDSQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRFPPATENFLYHLAAAEQMLKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry