AibGenesis™ Mouse Anti-FAM49B Antibody (CBMOAB-42468FYA)


Cat: CBMOAB-42468FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42468FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Horse (Equus caballus) WB, ELISA MO42468FYA 100 µg
MO-AB-03478H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03478C 100 µg
MO-AB-44716W Monoclonal Horse (Equus caballus) WB, ELISA MO44716W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Horse (Equus caballus)
CloneMO42468FYA
SpecificityThis antibody binds to Rhesus FAM49B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM49B Antibody is a mouse antibody against FAM49B. It can be used for FAM49B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM49B
UniProt IDF6YPA5
Protein RefseqThe length of the protein is 217 amino acids long.
The sequence is show below: MQKASWRTCNHTEELATKYERAIQHPADEKLQEKAWGAVVPLVGKLKKFYIFSEIRSSIKRSSGSLNKYPIFPHPASRARALAKQFAEILHFTLRFDELKMTNPAIQNDFSYYRRTLSRMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVSENKNLPIENTTDCLSTMASVCRVMLETPEYRSRFTNEETVSFLEGNGGRHNTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry