AibGenesis™ Mouse Anti-FAM76A Antibody (CBMOAB-42510FYA)


Cat: CBMOAB-42510FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42510FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO42510FYA 100 µg
CBMOAB-59920FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59920FYC 100 µg
MO-AB-10794W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10794W 100 µg
MO-AB-12341R Monoclonal Cattle (Bos taurus) WB, ELISA MO12341R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO42510FYA
SpecificityThis antibody binds to Rhesus FAM76A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM76A Antibody is a mouse antibody against FAM76A. It can be used for FAM76A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM76A
UniProt IDF6V882
Protein RefseqThe length of the protein is 349 amino acids long.
The sequence is show below: MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQERLECNGTISAHCNLCLPGSSDYPASASQVAGITGMRHHTQLIIKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP.
For Research Use Only | Not For Clinical Use.
Online Inquiry