AibGenesis™ Mouse Anti-FAM89A Antibody (CBMOAB-42538FYA)


Cat: CBMOAB-42538FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42538FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO42538FYA 100 µg
CBMOAB-76038FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76038FYA 100 µg
MO-AB-12349R Monoclonal Cattle (Bos taurus) WB, ELISA MO12349R 100 µg
MO-AB-23677W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23677W 100 µg
MO-AB-25774H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25774C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO42538FYA
SpecificityThis antibody binds to Rhesus FAM89A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM89A Antibody is a mouse antibody against FAM89A. It can be used for FAM89A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFamily with sequence similarity 89, member A; FAM89A
UniProt IDI2CY68
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: MSGARAAPGATGNGAVRGLRVDGLPPLPKSLSGLLHSASGGGASGGWRHLERLYAQKSRIQDELSRGGAGGGGARAAALPAKPPNLDAALALLRKEMVGLRQLDMSLLCQLYSLYESIQEYKGVCQAASSPDCTYALENGFFDEEEEYFQEQNSLHDRRDRGPPRDLSLPVSSLSSGDWILESI.
For Research Use Only | Not For Clinical Use.
Online Inquiry