AibGenesis™ Mouse Anti-FANK1 Antibody (CBMOAB-42577FYA)


Cat: CBMOAB-42577FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42577FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO42577FYA 100 µg
CBMOAB-76088FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76088FYA 100 µg
MO-AB-12365R Monoclonal Cattle (Bos taurus) WB, ELISA MO12365R 100 µg
MO-AB-16553W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16553W 100 µg
MO-AB-55248W Monoclonal Marmoset WB, ELISA MO55248W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO42577FYA
SpecificityThis antibody binds to Rhesus FANK1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytoskeleton; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FANK1 Antibody is a mouse antibody against FANK1. It can be used for FANK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFANK1
UniProt IDF6YJ70
Protein RefseqThe length of the protein is 371 amino acids long.
The sequence is show below: MEPQKITPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHSYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTRPSLSKNIVKIRMVTSVLHGPPTENTGEPISSEHLHRAVNVNDEDLLVRILQGGHVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVISLLEERKKKQRPKKSCVC.
For Research Use Only | Not For Clinical Use.
Online Inquiry