AibGenesis™ Mouse Anti-FBXL2 Antibody (CBMOAB-42660FYA)
Cat: CBMOAB-42660FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-42660FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO42660FYA | 100 µg | ||
| CBMOAB-76187FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO76187FYA | 100 µg | ||
| MO-AB-02579W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02579W | 100 µg | ||
| MO-AB-03703W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO03703W | 100 µg | ||
| MO-AB-12407R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12407R | 100 µg | ||
| MO-AB-25995W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25995W | 100 µg | ||
| MO-AB-55294W | Monoclonal | Marmoset | WB, ELISA | MO55294W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO42660FYA |
| Specificity | This antibody binds to Rhesus FBXL2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 12 tandem leucine-rich repeats. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus FBXL2 Antibody is a mouse antibody against FBXL2. It can be used for FBXL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | FBXL2 |
| UniProt ID | H9H3W5 |
| Protein Refseq | The length of the protein is 200 amino acids long. The sequence is show below: LKGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry