AibGenesis™ Mouse Anti-FBXO45 Antibody (CBMOAB-42700FYA)


Cat: CBMOAB-42700FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42700FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO42700FYA 100 µg
CBMOAB-76253FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76253FYA 100 µg
MO-AB-25785H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25785C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO42700FYA
SpecificityThis antibody binds to Rhesus FBXO45.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FBXO45 Antibody is a mouse antibody against FBXO45. It can be used for FBXO45 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesF-box/SPRY domain-containing protein 1; FBXO45
UniProt IDH9FAB8
Protein RefseqThe length of the protein is 248 amino acids long.
The sequence is show below: LPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG.
For Research Use Only | Not For Clinical Use.
Online Inquiry