AibGenesis™ Mouse Anti-FFAR4 Antibody (CBMOAB-42830FYA)


Cat: CBMOAB-42830FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42830FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO42830FYA 100 µg
Inquiry
MO-AB-03709W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03709W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO42830FYA
SpecificityThis antibody binds to Rhesus FFAR4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a G protein-coupled receptor (GPR) which belongs to the rhodopsin family of GPRs. The encoded protein functions as a receptor for free fatty acids, including omega-3, and participates in suppressing anti-inflammatory responses and insulin sensitizing. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus FFAR4 Antibody is a mouse antibody against FFAR4. It can be used for FFAR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFFAR4
UniProt IDF7GSF0
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: MSPECARAAGDAPLRSLEQANRTRFSFFSDVKGDHRLLLAAVETTVLALIFAVSLLGNVCALVLVARRRRRGTTACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYLMTLSGSVTILTLAARSLERMVCIVHLQRGLRGPRRARAVLLTLIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIAGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEQLLDARAVMTHSAITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSVISG.
For Research Use Only | Not For Clinical Use.
Online Inquiry