AibGenesis™ Mouse Anti-FITM2 Antibody (CBMOAB-42919FYA)


Cat: CBMOAB-42919FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42919FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO42919FYA 100 µg
CBMOAB-76562FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76562FYA 100 µg
MO-AB-12585R Monoclonal Cattle (Bos taurus) WB, ELISA MO12585R 100 µg
MO-AB-16117W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16117W 100 µg
MO-AB-55494W Monoclonal Marmoset WB, ELISA MO55494W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO42919FYA
SpecificityThis antibody binds to Rhesus FITM2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FITM2 Antibody is a mouse antibody against FITM2. It can be used for FITM2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFat storage-inducing transmembrane protein 2; FITM2
UniProt IDI0FMT8
Protein RefseqThe length of the protein is 262 amino acids long.
The sequence is show below: MEHLERCEWLLRGTLVRAAVRRYLPWALVASMLAGSLLKELSPLPESYLSNKRNVLNMYFVKMAWAWTFCLLLPFIALTNYHLTGKAGLVLRRLSTLLVGTAIWYICTSIFSNIEHYTGSCYQSPALEGVRKEHQSKQQCHQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLHEVKTDRSHCLHTAITTLVVALGILTFIWVLMFLCTAVYFHNLSQKVFGTLFGLLGWYGTYGFWYPKAFSPGLPPQSCSLNLKQDSYKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry