AibGenesis™ Mouse Anti-FJX1 Antibody (CBMOAB-42923FYA)


Cat: CBMOAB-42923FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42923FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes) WB, ELISA MO42923FYA 100 µg
MO-AB-01908Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01908Y 100 µg
MO-AB-18261W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18261W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes)
CloneMO42923FYA
SpecificityThis antibody binds to Rhesus FJX1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of this gene in humans is not known. (From NCBI)
Product OverviewMouse Anti-Rhesus FJX1 Antibody is a mouse antibody against FJX1. It can be used for FJX1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFour-jointed box protein 1; FJX1
UniProt IDH9FF88
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: LTLAAGADGPPRQSPGERRWHVPAGQPRPEESAAVHGGVFWSRGLEEQVPRGFSEAQAAAWLEVARGARVVSLERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLGLQRHVPPLALARVEARGAQWAQVQEELRAAHWTEGSVVSLTRWLPNLTDVVVPAPWRSEDGRLRPLRDAGGELANLSQAELVDLVQWTDLILFDYLTANFDRLVSNLFSLQWDPRVMQRATSNLHRGPGGALVFLDNEAGLVHGYRVAGMWDKYNEPLLQSVCVFRERTARRVLELHRGQDAAARLLRLYRP.
For Research Use Only | Not For Clinical Use.
Online Inquiry