AibGenesis™ Mouse Anti-GABRQ Antibody (CBMOAB-43297FYA)


Cat: CBMOAB-43297FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43297FYA Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO43297FYA 100 µg
MO-AB-55793W Monoclonal Marmoset WB, ELISA MO55793W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO43297FYA
SpecificityThis antibody binds to Rhesus GABRQ.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes the theta subunit of the GABA A receptor. The gene is mapped to chromosome Xq28 in a cluster of genes including those that encode the alpha 3 and epsilon subunits of the GABA A receptor. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus GABRQ Antibody is a mouse antibody against GABRQ. It can be used for GABRQ detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGABRQ
UniProt IDF7F4H2
Protein RefseqThe length of the protein is 150 amino acids long.
The sequence is show below: MLRAAVILLLIRTWLAEGNYPSPIPKFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGAMCDTNSTWGLNEDELMAHGHEKDNSSESEDSCPPSPGCSFTEGFSFDLFNPDYVPKVDKWSRFLFPLAFGLFNIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry