AibGenesis™ Mouse Anti-GCNT7 Antibody (CBMOAB-43473FYA)


Cat: CBMOAB-43473FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43473FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO43473FYA 100 µg
CBMOAB-77706FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77706FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO43473FYA
SpecificityThis antibody binds to Rhesus GCNT7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GCNT7 Antibody is a mouse antibody against GCNT7. It can be used for GCNT7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGCNT7
UniProt IDF7HAL3
Protein RefseqThe length of the protein is 294 amino acids long.
The sequence is show below: PLSTEEGDFSLAYIITIHKELAMFVQLLRAIYVPQNVYCIHVDEKAPKKYKTAVQTLVNCFENVFISSKREKMAYAGLTRLQADINCMKDLVHSKFQWNYVINLCGQDFPIKTNREIIHYIRSKWNDKNITPGAIQPPHINNRFKDKPPHNLTIYFGSAYYVLTRKFVEFILTDIRAKDMLQWSKDIRSPEQHYWVTLNQLKGATLDAGWEGNETKAARPLRPRHLCIWTRRPAMAHSVVFSVCLQIRTLDRPACSYLLRAAAQTSSAEAGRSSHRATLAFSPAESFQHENEPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry